Abstract
A total of 49 protein sequences of alkaline proteases retrieved from GenBank representing different species of Aspergillus have been characterized for various physiochemical properties, homology search, multiple sequence alignment, motif, and super family search and phylogenetic tree construction. The sequence level homology was obtained among different groups of alkaline protease enzymes, viz alkaline serine protease, oryzin, calpain-like protease, serine protease, subtilisin-like alkaline proteases. Multiple sequence alignment of alkaline protease protein sequence of different Aspergillus species revealed a stretch of conserved region for amino acid residues from 69 to 110 and 130–204. The phylogenetic tree constructed indicated several Aspergillus species-specific clusters for alkaline proteases namely Aspergillus fumigatus, Aspergillus niger, Aspergillus oryzae, Aspergillus clavatus. The distributions of ten commonly observed motifs were analyzed among these proteases. Motif 1 with a signature amino acid sequence of 50 amino acids, i.e., ASFSNYGKVVDIFAPGQDILSCWIGSTTATNTISGTSMATPHIVGLSCYL, was uniformly observed in proteases protein sequences indicating its involvement with the structure and enzymatic function. Motif analysis of acidic proteases of Aspergillus and bacterial alkaline proteases has revealed different signature amino acid sequences. The superfamily search for these proteases revealed the presence of subtilases, serine-carboxyl proteinase, calpain large subunit, and thermolysin-like superfamilies with 45 representing the subtilases superfamily.
Similar content being viewed by others
References
Callis, J. (1995). The Plant Cell, 7, 845–857.
Callis, J., & Vierstra, R. D. (2000). Current Opinion in Plant Biology, 3, 381–386.
Gottesman, S. (2003). Annual Review of Cell and Developmental Biology, 19, 565–587.
Ehrmann, M., & Clausen, T. (2004). Annual Review of Genetics, 38, 709–724.
Rawlings, N. D., Morton, F. R., & Barrett, A.J. (2007). In Polaina J., & MacCabe A.P. (Ed.), Industrial enzymes structure, function and applications (pp. 161–180). The Netherlands: Springer.
Rao, M. B., Tanksale, A. M., Ghatge, M. S., & Deshpande, V. V. (1998). Microbiology and Molecular Biology Reviews, 62, 597–635.
Boguslawski, G., Shultz, J. L., & Yehle, C. O. (1983). Analytical Biochemistry, 132, 41–49.
Jellouli, K., Bougatef, A., Manni, L., Agrebi, R., Siala, R., Younes, I., et al. (2009). Journal of Industrial Microbiology and Biotechnology, 36, 939–948.
Anwar, A., & Mohammed, S. (1998). Bioresource Technology, 64, 139–144.
Gupta, R., Beg, Q. K., & Lorenz, P. (2002). Applied Microbiology and Biotechnology, 59, 15–32.
Nishihira, J., & Tachikawa, H. (1999). Journal of Theoretical Biology, 196, 513–519.
Barett, A. J. (1994). Methods in Enzymology, 244, 1–15.
Katz, M. E., Rice, R. N., & Cheetham, B. F. (1994). Gene, 150, 287–292.
Tatsumi, H., Ogawa, Y., Murakami, S., Ishida, Y., Murakami, K., Masaki, A., et al. (1989). Molecular and General Genetics, 219, 33–38.
Ekici, O. D., Paetzel, M., & Dalbey, R. E. (2008). Protein Science, 17, 2023–2037.
Polgár, L. (2005). Cellular and Molecular Life Sciences, 62, 2161–2172.
Tsang, A., Butler, G., Powlowski, J., Panisko, E. A., & Baker, S. E. (2009). Fungal Genetics and Biology, 46, S153–S160.8.
Schuster, E., Dunn-Coleman, N., Frisvad, J. C., & van Dijck, P. W. (2002). Applied Microbiology and Biotechnology, 59, 426–435.
de Vries, R. P., & Visser, J. (2001). Microbiology and Molecular Biology Reviews, 65, 497–522.
Pandey, A., Soccol, C. R., & Mitchell, D. (2000). Process Biochemistry, 35, 1153–1169.
Morya, V. K., Dewaker, V., Mecarty, S. D., & Singh, R. (2010). Journal of Computer Science & Systems Biology, 3, 062–069.
Pel, H. J., de Winde, J. H., Archer, D. B., Dyer, P. S., Hofmann, G., Schaap, P. J., et al. (2007). Nature Biotechnology, 25, 221–231.
Dubey, A. K., Yadav, S., Kumar, M., Singh, V. K., Sarangi, B. K., & Yadav, D. (2010). 2010. Enzyme Research, 2010, 950230.
Yadav, P. K., Singh, V. K., Yadav, S., Yadav, K. D. S., & Yadav, D. (2009). Biochemistry (Moscow), 74(9), 1049–1055.
Yadav, V., Yadav, D., & Yadav, K. D. S. (2010). Online Journal of Bioinformatics, 11(2), 293–301.
Kyte, J., & Doolittle, R. F. (1982). Journal of Molecular Biology, 157, 105–132.
Bjellqvist, B., Hughes, G. J., Pasquali, C., Paquet, N., & Ravier, F. (1993). Electrophoresis, 14, 1023–1031.
Gill, S. C., & von Hippel, P. H. (1989). Analytical Biochemistry, 182, 319–326.
Guruprasad, K., Reddy, B. V. B., & Pandit, M. W. (1990). Protein Engineering, 4, 155–161.
Kumar, S., Tamura, K., & Nei, M. (2004). Briefings in Bioinformatics, 5, 150–163.
Saitou, N., & Nei, M. (1987). Molecular Biology and Evolution, 4, 406–425.
Ikai, A. (1980). Journal of Biochemistry (Tokyo), 88(6), 1895–1898.
Rawlings, N. D., Morton, F. R., & Barrett, A. J. (2006). Nucleic Acids Research, 34, D270–D272.
Rogers, S., Wells, R., & Rechsteiner, M. (1986). Science, 234, 364–368.
Whisstock, J. C., & Lesk, A. M. (2003). Quarterly Reviews of Biophysics, 36, 307–340.
Powers, R., Copeland, J. C., Germer, K., Mercier, K. A., Ramanathan, V., & Revesz, P. (2006). ROTEINS: Structure, Function, and Bioinformatics, 65, 124–135.
Gough, J., Karplus, K., Hughey, R., & Chothia, C. (2001). Journal of Molecular Biology, 313(4), 903–919.
Wright, C. S., Alden, R. A., & Kraut, J. (1969). Nature, 221, 235–242.
Carter, P., & Wells, J. A. (1988). Nature, 332, 564–568.
Wells, J. A., & Estell, D. A. (1988). Trends in Biochemical Sciences, 13, 291–297.
Rawlings, N. D., & Barrett, A. J. (1993). Biochemical Journal, 290, 205–218.
de Groot, A., Dulermo, R., Ortet, P., Blanchard, L., Guérin, P., Fernandez, B., et al. (2009). PLoS Genetics, 5(3), e1000434.
Acknowledgments
The authors wish to acknowledge Head, Department of Biotechnology, D.D.U Gorakhpur University, Gorakhpur for providing the infrastructural facilities. The financial support by UGC, India in the form of UGC- Major Project (F. no.37-133/2009-SR) to Dinesh Yadav and by DST, India in the form of Fast Track Young Scientist Fellowship (FT/LS-125/2008) to Sangeeta Yadav is duly acknowledged. Authors V.K. Morya and Eun-ki Kim are thankful to Inha University for facilitating the required assets.
Author information
Authors and Affiliations
Corresponding author
Rights and permissions
About this article
Cite this article
Morya, V.K., Yadav, S., Kim, EK. et al. In Silico Characterization of Alkaline Proteases from Different Species of Aspergillus . Appl Biochem Biotechnol 166, 243–257 (2012). https://doi.org/10.1007/s12010-011-9420-y
Received:
Accepted:
Published:
Issue Date:
DOI: https://doi.org/10.1007/s12010-011-9420-y